PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002370P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 323aa    MW: 35805.1 Da    PI: 8.6123
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002370P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.85.5e-4225101278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     C v+gC++dls++++yhrrhkvCe hsk+p+v+++gl+qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  MELO3C002370P1  25 CLVDGCNSDLSNCRDYHRRHKVCELHSKTPQVTIAGLKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQT 101
                     **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-341886IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.1292299IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-3923104IPR004333Transcription factor, SBP-box
PfamPF031104.3E-312598IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MASSTSGSSK RARGTHNGNT QPVSCLVDGC NSDLSNCRDY HRRHKVCELH SKTPQVTIAG  60
LKQRFCQQCS RFHSLEEFDE GKRSCRKRLD GHNRRRRKPQ TDLLPRSAAG PFSYHQGPPL  120
LPFTSSQVFP STTVSSHGWS SGGSDNATDP GVHHNRNPQL NFLEKQQSIF VETSDQTNNI  180
NNYKASPPLG LLHGGGGGSE RNKMIYDRFR IGINESDCAL SLLSSPQTQI QSDHQPQQQQ  240
QQQRNAAISL LHPLSTTHQN AFDNSSDTSS SSVQISNDTH HHHHHHHHHH HPHGVLNFSG  300
IFGISSDNPG NQSPSTLPFH WE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2925981184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18198KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439882.10.0PREDICTED: squamosa promoter-binding-like protein 13A
TrEMBLA0A0A0LWQ40.0A0A0A0LWQ4_CUCSA; Uncharacterized protein
STRINGVIT_17s0000g01260.t014e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2446333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-50SBP family protein